PDB entry 3fmy

View 3fmy on RCSB PDB site
Description: Structure of the C-terminal domain of the E. coli protein MQSA (YgiT/b3021)
Deposited on 2008-12-22, released 2010-01-12
The last revision was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.157
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator MQSA (ygiT/b3021)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3021, JW2989, ygiT
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fmyA (A:)
ghmasvnaetvapefivkvrkklsltqkeaseifgggvnafsryekgnaqphpstikllr
vldkhpellneir

    Sequence, based on observed residues (ATOM records):
    >3fmyA (A:)
aetvapefivkvrkklsltqkeaseifgggvnafsryekgnaqphpstikllrvldkhpe
llneir