PDB entry 3fmx

View 3fmx on RCSB PDB site
Description: Crystal structure of Tartrate dehydrogenase from Pseudomonas putida complexed with NADH
Class: oxidoreductase
Keywords: Oxidoreductase, Lyase, Magnesium, Manganese, NAD
Deposited on 2008-12-22, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.262
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Tartrate dehydrogenase/decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ttuC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51945
      • engineered (78)
    Domains in SCOPe 2.08: d3fmxx_
  • Heterogens: NAI, NH4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3fmxX (X:)
    mpahsfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmp
    ddwaeqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcal
    anrkvgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlae
    krerkhvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdv
    vvasnlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpia
    miwsgalmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtl
    arld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fmxX (X:)
    sfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmpddwa
    eqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcalanrk
    vgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlaekrer
    khvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdvvvas
    nlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpiamiws
    galmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtlarl