PDB entry 3fmp

View 3fmp on RCSB PDB site
Description: Crystal structure of the nucleoporin Nup214 in complex with the DEAD-box helicase Ddx19
Class: Oncoprotein/Hydrolase
Keywords: nuclear porin, nuclear pore complex, nucleocytoplasmic transport, mRNA export, protein interaction, helicase, beta-propeller, DEAD box, Glycoprotein, mRNA transport, Nucleus, Phosphoprotein, Protein transport, Proto-oncogene, Translocation, Transport, ATP-binding, Hydrolase, Membrane, Nucleotide-binding, RNA-binding, Protein transport-Hydrolase COMPLEX, Oncoprotein-Hydrolase COMPLEX
Deposited on 2008-12-22, released 2009-05-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.251
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear pore complex protein Nup214
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP214, CAIN, CAN, KIAA0023
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX19B
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX19B, DBP5, DDX19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fmpb_
  • Chain 'C':
    Compound: Nuclear pore complex protein Nup214
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP214, CAIN, CAN, KIAA0023
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP-dependent RNA helicase DDX19B
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX19B, DBP5, DDX19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fmpd_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fmpB (B:)
    matdswalavdeqeaaaeslsnlhlkeekikpdtngavvktnanaektdeeekedraaqs
    llnklirsnlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqe
    nalplmlaeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgk
    vieqmgkfypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfv
    ldeadvmiatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkre
    eetldtikqyyvlcssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghqv
    allsgemmveqraavierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdn
    etylhrigrtgrfgkrglavnmvdskhsmnilnriqehfnkkierldtddldeiekian
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fmpB (B:)
    lvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlae
    ppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfy
    pelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmia
    tqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fmpD (D:)
    matdswalavdeqeaaaeslsnlhlkeekikpdtngavvktnanaektdeeekedraaqs
    llnklirsnlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqe
    nalplmlaeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgk
    vieqmgkfypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfv
    ldeadvmiatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkre
    eetldtikqyyvlcssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghqv
    allsgemmveqraavierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdn
    etylhrigrtgrfgkrglavnmvdskhsmnilnriqehfnkkierldtddldeiekian
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fmpD (D:)
    lvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlae
    ppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfy
    pelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmia
    tqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk