PDB entry 3fm8

View 3fm8 on RCSB PDB site
Description: Crystal structure of full length centaurin alpha-1 bound with the FHA domain of KIF13B (CAPRI target)
Class: transport protein/hydrolase activator
Keywords: kinesin, GAP, GTPase activation, Structural Genomics Consortium, SGC, ATP-binding, Cytoskeleton, Microtubule, Motor protein, Nucleotide-binding, Phosphoprotein, Metal-binding, Nucleus, Zinc-finger, METAL BINDING PROTEIN, TRANSPORT PROTEIN-HYDROLASE ACTIVATOR COMPLEX
Deposited on 2008-12-19, released 2009-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF13B
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF13B, GAKIN, KIAA0639
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fm8a_
  • Chain 'B':
    Compound: Kinesin-like protein KIF13B
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF13B, GAKIN, KIAA0639
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fm8b_
  • Chain 'C':
    Compound: Centaurin-alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CENTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75689 (18-End)
      • expression tag (5-17)
      • see remark 999 (258)
  • Chain 'D':
    Compound: Centaurin-alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CENTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75689
      • see remark 999 (258)
  • Heterogens: UNX, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3fm8A (A:)
mhhhhhhssgrenlyfqggikvgddkcflvnlnadpalnellvyylkehtligsansqdi
qlcgmgilpehciiditsegqvmltpqkntrtfvngssvsspiqlhhgdrilwgnnhffr
lnlp

    Sequence, based on observed residues (ATOM records): (download) 
    >3fm8A (A:)
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsegqvmltp
qkntrtfvngssvsspiqlhhgdrilwgnnhffrlnlp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3fm8B (B:)
mhhhhhhssgrenlyfqggikvgddkcflvnlnadpalnellvyylkehtligsansqdi
qlcgmgilpehciiditsegqvmltpqkntrtfvngssvsspiqlhhgdrilwgnnhffr
lnlp

    Sequence, based on observed residues (ATOM records): (download) 
    >3fm8B (B:)
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsvmltpqkn
trtfvngssvsspiqlhhgdrilwgnnhffrlnlp

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.