PDB entry 3flz

View 3flz on RCSB PDB site
Description: P38 kinase crystal structure in complex WITH 8-Methyl-6-phenoxy-2-(tetrahydro-pyran-4-ylamino)-8H-pyrido[2,3-d]pyrimidin-7-one
Class: signaling protein, transferase
Keywords: P38; MAP KINASE; SERINE/THREONINE KINASE, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase, SIGNALING PROTEIN
Deposited on 2008-12-19, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3flza_
  • Heterogens: FLZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3flzA (A:)
    mrgshhhhhhgsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktgl
    rvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthl
    mgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkild
    fglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdh
    idqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekm
    lvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisf
    vpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3flzA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglhtddemtgyvat
    rwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgae
    llkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalah
    ayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp