PDB entry 3flj

View 3flj on RCSB PDB site
Description: crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (yp_168589.1) from silicibacter pomeroyi dss-3 at 2.00 a resolution
Deposited on 2008-12-18, released 2009-01-13
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein conserved in bacteria with a cystatin-like fold
    Species: Silicibacter pomeroyi DSS-3 [TaxId:246200]
    Gene: SPO3393, YP_168589.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LN19 (19-154)
      • leader sequence (14-18)
  • Heterogens: UNL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fljA (A:)
mgsdkihhhhhhenlyfqgmhptiarmqevvakgdeslihallaedvrfmpptyyktwtg
rdpvaavlghvgqvfsefryrrimgegkdwalefqckvgeldavgvdlitlneggliqdf
evvmrpyktvgalrdamnarvmtdarflkyreals

    Sequence, based on observed residues (ATOM records):
    >3fljA (A:)
lyfqgmhptiarmqevvakgdeslihallaedvrfmpptyyktwtgrdpvaavlghvgqv
fsefryrrimgegkdwalefqckvgeldavgvdlitlneggliqdfevvmrpyktvgalr
damnarvmtdarflkyreals