PDB entry 3fl8

View 3fl8 on RCSB PDB site
Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with RAB1, a TMP-dihydrophthalazine derivative
Class: oxidoreductase
Keywords: oxidoreductase, pyrimidine, dihydrophthalazine
Deposited on 2008-12-18, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8a1, d3fl8a2
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8b1, d3fl8b2
  • Chain 'C':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8c1, d3fl8c2
  • Chain 'D':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8d1, d3fl8d2
  • Chain 'E':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8e1, d3fl8e2
  • Chain 'F':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8f1, d3fl8f2
  • Chain 'G':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8g1, d3fl8g2
  • Chain 'H':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, DHFR, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (0-161)
      • expression tag (162-165)
    Domains in SCOPe 2.07: d3fl8h1, d3fl8h2
  • Heterogens: CA, RAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8A (A:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8B (B:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8C (C:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8D (D:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8E (E:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8F (F:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fl8G (G:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fl8H (H:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
    fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fl8H (H:)
    mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
    iivtrncevahsveevfelceeeififggaqiydlflpyvdklyitkihhafegdtffpe
    mdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr