PDB entry 3fl2

View 3fl2 on RCSB PDB site
Description: crystal structure of the ring domain of the e3 ubiquitin-protein ligase uhrf1
Deposited on 2008-12-18, released 2009-01-20
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICBP90, NP95, RNF106, UHRF1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fl2A (A:)
gsepysltaqqssliredksnaklwnevlaslkdrpasgspfqlflskveetfqciccqe
lvfrpittvcqhnvckdcldrsfraqvfscpacrydlgrsyamqvnqplqtvlnqlfpgy
gngr

    Sequence, based on observed residues (ATOM records):
    >3fl2A (A:)
sltaqqssliredksnaklwnevlasrpasgspfqlflskveetfqciccqelvfrpitt
vcqhnvckdcldrsfraqvfscpacrydlgrsyamqvnqplqtvlnqlfpgygngr