PDB entry 3fkz
View 3fkz on RCSB PDB site
Description: X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease
Class: hydrolase
Keywords: 3D-domain swapping, bovine seminal ribonuclease, non-covalent dimer, antitumor activity, quaternary structure flexibility, protein mutations and evolution, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on
2008-12-18, released
2009-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-10-06, with a file datestamp of
2009-10-02.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.188
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease pancreatic
Species: Bos taurus [TaxId:9913]
Gene: RNASE1, RNS1
Database cross-references and differences (RAF-indexed):
- Uniprot P61823 (0-123)
- engineered (15-16)
- engineered (18-19)
- engineered (30-31)
Domains in SCOPe 2.08: d3fkza_ - Chain 'B':
Compound: ribonuclease pancreatic
Species: Bos taurus [TaxId:9913]
Gene: RNASE1, RNS1
Database cross-references and differences (RAF-indexed):
- Uniprot P61823 (0-123)
- engineered (15-16)
- engineered (18-19)
- engineered (30-31)
Domains in SCOPe 2.08: d3fkzb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3fkzA (A:)
ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3fkzB (B:)
ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv