PDB entry 3fkz

View 3fkz on RCSB PDB site
Description: X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease
Class: hydrolase
Keywords: 3D-domain swapping, bovine seminal ribonuclease, non-covalent dimer, antitumor activity, quaternary structure flexibility, protein mutations and evolution, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2008-12-18, released 2009-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • engineered (15-16)
      • engineered (18-19)
      • engineered (30-31)
    Domains in SCOPe 2.08: d3fkza_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • engineered (15-16)
      • engineered (18-19)
      • engineered (30-31)
    Domains in SCOPe 2.08: d3fkzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fkzA (A:)
    ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fkzB (B:)
    ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv