PDB entry 3fkd

View 3fkd on RCSB PDB site
Description: The crystal structure of L-threonine-O-3-phosphate decarboxylase from Porphyromonas gingivalis
Class: lyase
Keywords: 11247b, structural genomic, L-threonine-O-3-phosphate decarboxylase Porphyromonas gingivalis, , Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, lyase
Deposited on 2008-12-16, released 2009-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-Threonine-O-3-Phosphate Decarboxylase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: PG_0012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fkda_
  • Chain 'B':
    Compound: L-Threonine-O-3-Phosphate Decarboxylase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: PG_0012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fkdb_
  • Chain 'C':
    Compound: L-Threonine-O-3-Phosphate Decarboxylase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: PG_0012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fkdc_
  • Chain 'D':
    Compound: L-Threonine-O-3-Phosphate Decarboxylase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: PG_0012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fkdd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fkdA (A:)
    mifghgdegitplsseivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmla
    krnsvdnnailvtngptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsne
    digeadfsnmdfcwlcnpnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirp
    adikgrknlvmvysfshaygipglrigyivankdfmkrvaafstpwavnalaieaakfil
    ihpaqftlpirkwqrntvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleey
    nmlirdasnfrgldesyvrittqrpaqnqlfikaletflekyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkdA (A:)
    eivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmlakrnsvdnnailvtng
    ptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwl
    cnpnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysf
    shaygipglrigyivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqr
    ntvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleeynmlirdasnfrglde
    syvrittqrpaqnqlfikaletflek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fkdB (B:)
    mifghgdegitplsseivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmla
    krnsvdnnailvtngptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsne
    digeadfsnmdfcwlcnpnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirp
    adikgrknlvmvysfshaygipglrigyivankdfmkrvaafstpwavnalaieaakfil
    ihpaqftlpirkwqrntvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleey
    nmlirdasnfrgldesyvrittqrpaqnqlfikaletflekyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkdB (B:)
    ivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmlakrnsvdnnailvtngp
    taafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwlc
    npnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysfs
    haygipglrigyivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqrn
    tvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleeynmlirdasnfrgldes
    yvrittqrpaqnqlfikaletflek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fkdC (C:)
    mifghgdegitplsseivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmla
    krnsvdnnailvtngptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsne
    digeadfsnmdfcwlcnpnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirp
    adikgrknlvmvysfshaygipglrigyivankdfmkrvaafstpwavnalaieaakfil
    ihpaqftlpirkwqrntvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleey
    nmlirdasnfrgldesyvrittqrpaqnqlfikaletflekyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkdC (C:)
    ivnfsttvwtdgddhlekhlvenlncirhypepdagtlrqmlakrnsvdnnailvtngpt
    aafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwlcn
    pnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysfsh
    aygipglrigyivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqrnt
    vdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleeynmlirdasnfrgldesy
    vrittqrpaqnqlfikaletfleky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fkdD (D:)
    mifghgdegitplsseivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmla
    krnsvdnnailvtngptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsne
    digeadfsnmdfcwlcnpnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirp
    adikgrknlvmvysfshaygipglrigyivankdfmkrvaafstpwavnalaieaakfil
    ihpaqftlpirkwqrntvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleey
    nmlirdasnfrgldesyvrittqrpaqnqlfikaletflekyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkdD (D:)
    sttvwtdgkdhlekhlvenlncirhypepdagtlrqmlakrnsvdnnailvtngptaafy
    qiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwlcnpnnp
    dgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysfshaygi
    pglrigyivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqrntvdfi
    talnrldgvevhpsgttffllrlkkgtaaelkknmlirdasnfrgldesyvrittqrpaq
    nqlfikalet