PDB entry 3fkb

View 3fkb on RCSB PDB site
Description: Structure of NDPK H122G and tenofovir-diphosphate
Class: transferase
Keywords: An hexamer structure, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide metabolism, Nucleotide-binding, Phosphoprotein, Transferase
Deposited on 2008-12-16, released 2009-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.181
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkba_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkbb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkbc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkbd_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkbe_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.03: d3fkbf_
  • Heterogens: TNM, MG, EDO, GOL, TNV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fkbA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fkbB (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fkbC (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fkbD (D:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbD (D:)
    nkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffg
    glvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsds
    vesanreialwfkpeelltevkpnpnlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fkbE (E:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbE (E:)
    nkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffg
    glvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsds
    vesanreialwfkpeelltevkpnpnlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fkbF (F:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fkbF (F:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye