PDB entry 3fk8

View 3fk8 on RCSB PDB site
Description: The crystal structure of disulphide isomerase from Xylella fastidiosa Temecula1
Deposited on 2008-12-16, released 2009-01-13
The last revision was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.155
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disulphide isomerase
    Species: Xylella fastidiosa [TaxId:183190]
    Gene: PD_1033, Xylella fastidiosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87CN2 (3-132)
      • expression tag (2)
  • Heterogens: FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fk8A (A:)
snalnlpydehadawtqvkkalaagkrthkptllvfganwctdcraldkslrnqkntali
akhfevvkidvgnfdrnlelsqaygdpiqdgipavvvvnsdgkvryttkggelanarkms
dqgiydffakite

    Sequence, based on observed residues (ATOM records):
    >3fk8A (A:)
alnlpydehadawtqvkkalaagkrthkptllvfganwctdcraldkslrnqkntaliak
hfevvkidvgnfdrnlelsqaygdpiqdgipavvvvnsdgkvryttkggelanarkmsdq
giydffakite