PDB entry 3fk7

View 3fk7 on RCSB PDB site
Description: Crystal structure of TetR triple mutant (H64K, S135L, S138I) in complex with 4-ddma-atc
Class: transcription
Keywords: Tetracycline repressor, bacterial transcription regulation, altered inducer specificity, 4-de-dimethylamino-anhydrotetracycline, Antibiotic resistance, DNA-binding, Magnesium, Metal-binding, Repressor, Transcription, Transcription regulation, Transposable element
Deposited on 2008-12-16, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-49)
    • Uniprot P0ACT4 (50-End)
      • engineered (63)
      • engineered (134)
      • engineered (137)
    Domains in SCOPe 2.07: d3fk7a1, d3fk7a2
  • Chain 'B':
    Compound: tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-49)
    • Uniprot P0ACT4 (50-End)
      • engineered (63)
      • engineered (134)
      • engineered (137)
    Domains in SCOPe 2.07: d3fk7b1, d3fk7b2
  • Heterogens: MG, 4DM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fk7A (A:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveil
    arhkdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfm
    tengfslrdglyailavihftlgavleqqehtaaltdrpaapdenlppllrealqimdsd
    dgeqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fk7A (A:)
    ldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveilarh
    kdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyailavihftlgavleqqehtaaltdapdenlppllrealqimdsddgeqaf
    lhgleslirgfevqltallq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fk7B (B:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveil
    arhkdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfm
    tengfslrdglyailavihftlgavleqqehtaaltdrpaapdenlppllrealqimdsd
    dgeqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fk7B (B:)
    ldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveilarh
    kdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyailavihftlgavleqqehtaaltdrpnlppllrealqimdsddgeqaflh
    gleslirgfevqltall