PDB entry 3fk4

View 3fk4 on RCSB PDB site
Description: Crystal structure of RuBisCO-like protein from Bacillus Cereus ATCC 14579
Class: isomerase
Keywords: Structural genomics, RuBisCO-like protein. NYSGXRC, target 9463a, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Amino-acid biosynthesis, Isomerase, Magnesium, Metal-binding, Methionine biosynthesis
Deposited on 2008-12-15, released 2009-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RuBisCO-like protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: mtnW, BC_4036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fk4a1, d3fk4a2
  • Chain 'B':
    Compound: RuBisCO-like protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: mtnW, BC_4036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fk4b1, d3fk4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fk4A (A:)
    msgiiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaeh
    ehtnsylrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkh
    fpgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilf
    enaltpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfn
    vfaygldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslf
    pspygsvalekeealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinag
    ggihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwgnpsyevkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fk4A (A:)
    giiatylihddshnlekkaeqialgltigeqlkqhkgnvihveelaehehtnsylrkkvk
    rgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhfpgpkfgidgir
    nllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfenaltpltkriv
    sgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnvfaygldvlqsl
    aeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfpspykeealais
    kylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagggihghpngaqgggkafr
    taidatlqnkplhevddinlhsalqiwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fk4B (B:)
    msgiiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaeh
    ehtnsylrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkh
    fpgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilf
    enaltpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfn
    vfaygldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslf
    pspygsvalekeealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinag
    ggihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwgnpsyevkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fk4B (B:)
    giiatylihddshnlekkaeqialgltiglphllqeqlkqhkgnvihveelaehehtnsy
    lrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhfpgpkf
    gidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfltpltk
    rivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnvfaygldvl
    qslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfpspykeeal
    aiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagggihghpngaqgggk
    afrtaidatlqnkplhevddinlhsalqiwg