PDB entry 3fjb

View 3fjb on RCSB PDB site
Description: Crystal structure of V31I mutant of Human acidic fibroblast growth factor
Class: hormone
Keywords: beta-trefoil, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, HORMONE
Deposited on 2008-12-14, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (36)
    Domains in SCOPe 2.06: d3fjba1, d3fjba2
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (36)
    Domains in SCOPe 2.06: d3fjbb1, d3fjbb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fjbA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtidgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fjbA (A:)
    hhhfnlppgnykkpkllycsngghflrilpdgtidgtrdrsdqhiqlqlsaesvgevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fjbB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtidgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fjbB (B:)
    hhhfnlppgnykkpkllycsngghflrilpdgtidgtrdrsdqhiqlqlsaesvgevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv