PDB entry 3fj5

View 3fj5 on RCSB PDB site
Description: Crystal structure of the c-src-SH3 domain
Class: transferase
Keywords: beta shandwich, TRANSFERASE, ATP-binding, Kinase, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Tyrosine-protein kinase
Deposited on 2008-12-14, released 2009-03-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.206
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: c-SRC, SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-56)
      • expression tag (0)
      • engineered (44)
    Domains in SCOPe 2.05: d3fj5a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: c-SRC, SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-56)
      • expression tag (0)
      • engineered (44)
    Domains in SCOPe 2.05: d3fj5b_
  • Heterogens: PGE, SO4, ACT, GOL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fj5A (A:)
    mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fj5B (B:)
    mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps