PDB entry 3fiv

View 3fiv on RCSB PDB site
Description: crystal structure of feline immunodeficiency virus protease complexed with a substrate
Deposited on 1997-07-09, released 1997-11-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3fiva_
  • Chain 'B':
    Domains in SCOP 1.57: d3fivb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fivA (A:)
ttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggkrg
tnyinvhleirdenyktqaifgnvcvlednsliqpllgrdnmikfnirlvm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fivB (B:)
ttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggkrg
tnyinvhleirdenyktqaifgnvcvlednsliqpllgrdnmikfnirlvm