PDB entry 3fio

View 3fio on RCSB PDB site
Description: Crystal structure of a fragment of a cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain
Deposited on 2008-12-12, released 2009-01-20
The last revision was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: A cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1953
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TZN4 (0-69)
• Chain 'B':
  Compound: A cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1953
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TZN4 (0-69)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fioA (A:)
  kaivvqpkdtvdrvakilsrnkagsavvmegdeilgvvterdildkvvakgknpkevkve
  eimtknpvki
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fioB (B:)
  kaivvqpkdtvdrvakilsrnkagsavvmegdeilgvvterdildkvvakgknpkevkve
  eimtknpvki