PDB entry 3fib

View 3fib on RCSB PDB site
Description: recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0: a further refinement of pdb entry 1fib, and differs from 1fib by the modelling of a cis peptide bond between residues k338 and c339
Class: blood coagulation
Keywords: fibrinogen, blood coagulation, fibrin polymerization, cis peptide bonds
Deposited on 1997-07-14, released 1997-09-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.154
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fibrinogen gamma chain residues
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02679 (0-248)
  Domains in SCOPe 2.01: d3fiba_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fibA (A:)
  qihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvd
  fkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadya
  mfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfe
  gncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkktt
  mkiipfnrl