PDB entry 3fhv

View 3fhv on RCSB PDB site
Description: Structural basis of Salmonella typhi type IVb PilS and cystic fibrosis transmembrane conductance regulator (CFTR) interaction
Class: cell adhesion/membrane protein
Keywords: pils complex, cftr, CELL ADHESION-MEMBRANE PROTEIN COMPLEX
Deposited on 2008-12-10, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prepilin
    Species: SALMONELLA TYPHI [TaxId:601]
    Gene: pilS, STY4547, t4247
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fhva_
  • Chain 'B':
    Compound: Prepilin
    Species: SALMONELLA TYPHI [TaxId:601]
    Gene: pilS, STY4547, t4247
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fhvb_
  • Chain 'C':
    Compound: cftr peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FHV (0-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fhvA (A:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhvA (A:)
    agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
    nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
    akvtaeiassectadngrtgtntlvfnyng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fhvB (B:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhvB (B:)
    agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
    nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
    akvtaeiassectadngrtgtntlvfnyng
    

  • Chain 'C':
    No sequence available.