PDB entry 3fhu

View 3fhu on RCSB PDB site
Description: Crystal strcuture of type IV b pilin from Salmonella typhi
Class: cell adhesion
Keywords: pilin, CELL ADHESION
Deposited on 2008-12-10, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prepilin
    Species: SALMONELLA TYPHI [TaxId:601]
    Gene: pilS, STY4547, t4247
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fhua_
  • Chain 'B':
    Compound: Prepilin
    Species: SALMONELLA TYPHI [TaxId:601]
    Gene: pilS, STY4547, t4247
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fhub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fhuA (A:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhuA (A:)
    agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
    nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
    akvtaeiassectadngrtgtntlvfnyng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fhuB (B:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhuB (B:)
    agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
    nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
    akvtaeiassectadngrtgtntlvfnyng