PDB entry 3fhr

View 3fhr on RCSB PDB site
Description: High resolution crystal structure of mitogen-activated protein kinase-activated protein kinase 3 (MK3)-inhibitor complex
Class: transferase
Keywords: Kinase-inhibitor complex, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-12-10, released 2009-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3fhra_
  • Heterogens: P4O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fhrA (A:)
    mahhhhhhssglevlfqgpepkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalk
    llydspkarqevdhhwqasggphivcildvyenmhhgkrclliimecmeggelfsriqer
    gdqaftereaaeimrdigtaiqflhshniahrdvkpenllytskekdavlkltdfgfake
    ttqnalqtpcytpyyvapevlgpekydkscdmwslgvimyillcgfppfysntgqaispg
    mkrrirlgqygfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqt
    plhtarvlqedkdhwdevkeemtsalatmrvdydqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhrA (A:)
    epkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalkllydspkarqevdhhwqas
    ggphivcildvyenmhhgkrclliimecmeggelfsriqerdqaftereaaeimrdigta
    iqflhshniahrdvkpenllytskekdavlkltdfgfaketekydkscdmwslgvimyil
    lcgfppfgfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtplh
    tarvlqedkdhwdevkeemtsalatmrvdydqv