PDB entry 3fhg

View 3fhg on RCSB PDB site
Description: crystal structure of sulfolobus solfataricus 8-oxoguanine dna glycosylase (ssogg)
Deposited on 2008-12-09, released 2009-05-19
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: 1451601, MJ0724, ogg, SSO0904
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZK2 (0-206)
      • engineered mutation (127)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fhgA (A:)
mlrslvqnpkvrarvlervdefrlnnlsneevwfreltlclltanssfisayqalnclgq
kiyyaneeeirnilksckyrfynlkakyiimarekvygrlkeeikpladedqqlarerll
nikgigmqeashflrnvgyfdlaiidrhiidfmrrigaigetnvkqlskslyisfenilk
siasnlnmsvgildlfiwyketntivk