PDB entry 3fhc

View 3fhc on RCSB PDB site
Description: Crystal structure of human Dbp5 in complex with Nup214
Class: transport protein/hydrolase
Keywords: DEAD-box helicase, mRNA export, Nucleoporin, beta propeller, RecA-like, RNA dependent ATPase, CAN, Ddx19, Dead-box protein 19b, nuclear pore complex, Glycoprotein, mRNA transport, Nucleus, Phosphoprotein, Protein transport, Proto-oncogene, Translocation, Transport, ATP-binding, Helicase, Hydrolase, Membrane, Nucleotide-binding, RNA-binding, TRANSPORT PROTEIN-HYDROLASE COMPLEX
Deposited on 2008-12-09, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear pore complex protein Nup214
    Species: Homo sapiens [TaxId:9606]
    Gene: Nup214 (Residues 1-405)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX19B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dbp5 (Residues 68-302)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fhcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fhcB (B:)
    snlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplml
    aeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgk
    fypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvm
    iatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkreee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhcB (B:)
    nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
    iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
    ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq
    dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk