PDB entry 3fhb

View 3fhb on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor 3-aminobenzoic acid
Class: transferase
Keywords: transferase, enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, Glycosyltransferase, NAD, Nucleus
Deposited on 2008-12-09, released 2009-01-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP3, ADPRT3, ADPRTL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6F1 (2-356)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3fhba1, d3fhba2
  • Heterogens: GAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fhbA (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh