PDB entry 3fh2

View 3fh2 on RCSB PDB site
Description: the crystal structure of the probable atp-dependent protease (heat shock protein) from corynebacterium glutamicum
Deposited on 2008-12-08, released 2008-12-23
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable ATP-dependent protease (heat shock protein)
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg2963, Cgl2678, clpC, GI:41326857
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NMA0 (2-144)
      • expression tag (0-1)
      • expression tag (145)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fh2A (A:)
qamferftdrarrvivlaqeearmlnhnyigtehillglihegegvaakalesmgislda
vrqeveeiigqgsqpttghipftprakkvlelslreglqmghkyigteflllgliregeg
vaaqvlvklgadlprvrqqviqllsg