PDB entry 3fgz

View 3fgz on RCSB PDB site
Description: Crystal Structure of CheY triple mutant F14E, N59M, E89R complexed with BeF3- and Mn2+
Class: signaling protein
Keywords: Response Regulator, Receiver Domain, BeF3, Two-Component Signal Transduction, Chemotaxis, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2008-12-08, released 2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • engineered (12)
      • engineered (57)
      • engineered (87)
    Domains in SCOPe 2.08: d3fgza_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • engineered (12)
      • engineered (57)
      • engineered (87)
    Domains in SCOPe 2.08: d3fgzb_
  • Heterogens: MN, BEF, GOL, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fgzA (A:)
    adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
    nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fgzB (B:)
    adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
    nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm