PDB entry 3ffx
View 3ffx on RCSB PDB site
Description: Crystal Structure of CheY triple mutant F14E, N59R, E89H complexed with BeF3- and Mn2+
Class: signaling protein
Keywords: Response Regulator, Receiver Domain, BeF3, Two-Component Signal Transduction, Chemotaxis, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on
2008-12-04, released
2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-01, with a file datestamp of
2017-10-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered (12)
- engineered (57)
- engineered (87)
Domains in SCOPe 2.08: d3ffxa_ - Chain 'B':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered (12)
- engineered (57)
- engineered (87)
Domains in SCOPe 2.08: d3ffxb_ - Heterogens: MN, BEF, SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ffxA (A:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtahakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ffxB (B:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtahakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm