PDB entry 3ffr

View 3ffr on RCSB PDB site
Description: crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution
Class: transferase
Keywords: phosphoserine aminotransferase serc, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, transferase
Deposited on 2008-12-04, released 2008-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine aminotransferase SerC
    Species: Cytophaga hutchinsonii ATCC 33406 [TaxId:269798]
    Gene: CHU_0995, serC, YP_677612.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11WE4 (1-361)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3ffra1, d3ffra2
  • Heterogens: SER, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ffrA (A:)
    gmnnkiyftpgpselyptvrqhmitaldekigvishrskkfeevyktasdnlktllelps
    nyevlflasateiweriiqncvekksfhcvngsfskrfyefagelgreaykeeaafgkgf
    ypaditvpadaeiiclthnetssgvsmpvedintfrdknkdalifvdavsslpypkfdwt
    kidsvffsvqkcfglpaglgvwilndrviekskallakrksigtyhtipsmlekarvnqt
    petpnamnifllgkvtgdmlqisadgirkqteekaalintyiesskvfsfgvedaklrsm
    ttivanttmlpgeinkilepfdmavgagygskketqirianfpahsleqvhklvqtlkek
    ig