PDB entry 3ffq

View 3ffq on RCSB PDB site
Description: HCN2I 443-640 apo-state
Class: metal transport
Keywords: Ion transport, Ion channel, Membrane, Nucleotide-binding, Potassium, Potassium channel, Sodium channel, Transmembrane, Voltage-gated channel, cAMP, cAMP-binding, Glycoprotein, Ionic channel, Phosphoprotein, Potassium transport, Sodium transport, Transport, METAL TRANSPORT
Deposited on 2008-12-04, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Bcng2, bcng2 or hac1, Hac1, Hcn2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ffqa_
  • Chain 'B':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Bcng2, bcng2 or hac1, Hac1, Hcn2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ffqb_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ffqA (A:)
    gsamdssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngp
    lreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiq
    hgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleey
    pmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ffqA (A:)
    srrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreeiv
    nfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvsv
    ltnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
    tvai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ffqB (B:)
    gsamdssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngp
    lreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiq
    hgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleey
    pmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ffqB (B:)
    dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
    ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
    svltkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrraf
    etva