PDB entry 3ffo

View 3ffo on RCSB PDB site
Description: F17b-G lectin domain with bound GlcNAc(beta1-2)man
Class: sugar binding protein
Keywords: bacterial adhesin, lectin, bacterial attachment, pathogenesis, immunoglobulin fold, Cell projection, Fimbrium, SUGAR BINDING PROTEIN
Deposited on 2008-12-04, released 2009-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adhesin
  Species: Escherichia coli [TaxId:562]
  Gene: F17b-G
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47200 (0-175)
  Domains in SCOPe 2.04: d3ffoa_
• Heterogens: NI, TRS, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ffoA (A:)
  vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
  dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
  svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt