PDB entry 3ffo

View 3ffo on RCSB PDB site
Description: F17b-G lectin domain with bound GlcNAc(beta1-2)man
Class: sugar binding protein
Keywords: bacterial adhesin, lectin, bacterial attachment, pathogenesis, immunoglobulin fold, Cell projection, Fimbrium, SUGAR BINDING PROTEIN
Deposited on 2008-12-04, released 2009-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adhesin
    Species: Escherichia coli [TaxId:562]
    Gene: F17b-G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ffoa_
  • Heterogens: NI, TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ffoA (A:)
    vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt