PDB entry 3ffh

View 3ffh on RCSB PDB site
Description: The crystal structure of histidinol-phosphate aminotransferase from Listeria innocua Clip11262.
Class: transferase
Keywords: APC88260, histidinol-phosphate aminotransferase, Listeria innocua Clip11262, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, Amino-acid biosynthesis, Aminotransferase, Histidine biosynthesis, Pyridoxal phosphate, Transferase
Deposited on 2008-12-03, released 2008-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Listeria innocua [TaxId:1642]
    Gene: hisC, lin2039, Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92A83 (3-362)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ffha1, d3ffha2
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Listeria innocua [TaxId:1642]
    Gene: hisC, lin2039, Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92A83 (3-362)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ffhb1, d3ffhb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ffhA (A:)
    snamkwkkslaglssykpgkreeevmaelgltkitklssnenplgtskkvaaiqanssve
    teiypdgwasslrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvq
    yrqnaliegaevreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqaf
    ldrvpsdvlvvldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiad
    keiirqlnivrppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvkl
    ypangnfvlidlgieagtifsylekngyitrsgaalgfptavritigkeednsavialle
    kll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ffhA (A:)
    namkwkkslaglsskreeevmaelgltkitklssnenplgtskkvaaiqanssveteiya
    sslrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrqnalieg
    aevreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafldrvpsdvl
    vvldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadkeiirqlni
    vrppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklypangnfvl
    idlgieagtifsylekngyitrsgaalgfptavritigkeednsaviallekll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ffhB (B:)
    snamkwkkslaglssykpgkreeevmaelgltkitklssnenplgtskkvaaiqanssve
    teiypdgwasslrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvq
    yrqnaliegaevreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqaf
    ldrvpsdvlvvldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiad
    keiirqlnivrppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvkl
    ypangnfvlidlgieagtifsylekngyitrsgaalgfptavritigkeednsavialle
    kll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ffhB (B:)
    amkwkkslaglsreeevmaelgltkitklssnenplgtskkvaaiqanssveteiypass
    lrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrqnaliegae
    vreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafldrvpsdvlvv
    ldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadkeiirqlnivr
    ppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklypangnfvlid
    lgieagtifsylekngyitrsgaalgfptavritigkeednsaviallekll