PDB entry 3ff9

View 3ff9 on RCSB PDB site
Description: Structure of NK cell receptor KLRG1
Class: immune system
Keywords: Natural Killer cell receptor KLTG1, Glycoprotein, Lectin, Membrane, Phosphoprotein, Receptor, Signal-anchor, Transmembrane, IMMUNE SYSTEM
Deposited on 2008-12-02, released 2009-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily G member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Klrg1, Mafa
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88713 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.06: d3ff9a1, d3ff9a2
  • Chain 'B':
    Compound: Killer cell lectin-like receptor subfamily G member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Klrg1, Mafa
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88713 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.06: d3ff9b1, d3ff9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ff9A (A:)
mcpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywi
glrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ff9B (B:)
mcpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywi
glrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly