PDB entry 3ff5

View 3ff5 on RCSB PDB site
Description: Crystal structure of the conserved N-terminal domain of the peroxisomal matrix-protein-import receptor, Pex14p
Deposited on 2008-12-01, released 2008-12-30
The last revision was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal biogenesis factor 14
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pex14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q642G4 (8-53)
      • expression tag (0-7)
  • Chain 'B':
    Compound: Peroxisomal biogenesis factor 14
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pex14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q642G4 (8-53)
      • expression tag (0-7)
  • Heterogens: DPW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ff5A (A:)
gplgspefrepliatavkflqnsrvrqsplatrraflkkkgltdeeidlafqqs

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ff5B (B:)
gplgspefrepliatavkflqnsrvrqsplatrraflkkkgltdeeidlafqqs