PDB entry 3fez

View 3fez on RCSB PDB site
Description: crystal structure of uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases (yp_014836.1) from listeria monocytogenes 4b f2365 at 2.10 a resolution
Deposited on 2008-12-01, released 2008-12-16
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases
    Species: Listeria monocytogenes str. 4b F2365 [TaxId:265669]
    Gene: LMOf2365_2246, YP_014836.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71XF2 (19-End)
      • leader sequence (12-18)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fezA (A:)
mgsdkihhhhhhenlyfqgmkkvfittgtehylrqlmanytggnvtllqnfsqsllyqes
tgeklfqegaeyrvlqssgslkgfgvvvfeyihlrdeeipiflqmyqraslhfsetpglq
stkltkamnmnkfliisfwdsevffhdwkktplskeitnimkknntqsgfshediyhype
fshdak

    Sequence, based on observed residues (ATOM records):
    >3fezA (A:)
enlyfqgmkkvfittgtehylrqlmanytggnvtllqnfsqsllyqestgeklfqegaey
rvlqssgslkgfgvvvfeyihlrdeeipiflqmyqraslhfsetpglqstkltkamnmnk
fliisfwdsevffhdwkktplskeitnimkknntqsgfshediyhypef