PDB entry 3fev

View 3fev on RCSB PDB site
Description: Crystal structure of the chimeric muscarinic toxin MT7 with loop 1 from MT1.
Deposited on 2008-12-01, released 2009-12-22
The last revision was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.216
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1
  Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81030 (0-15)
  • Uniprot Q8QGR0 (16-64)
• Chain 'B':
  Compound: Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1
  Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81030 (0-15)
  • Uniprot Q8QGR0 (16-64)
• Chain 'C':
  Compound: Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1
  Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81030 (0-15)
  • Uniprot Q8QGR0 (16-64)
• Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fevA (A:)
  ltcvtsksifgittencpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
  dkcnk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fevB (B:)
  ltcvtsksifgittencpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
  dkcnk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fevC (C:)
  ltcvtsksifgittencpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
  dkcnk