PDB entry 3fep

View 3fep on RCSB PDB site
Description: Crystal structure of the R132K:R111L:L121E:R59W-CRABPII mutant complexed with a synthetic ligand (merocyanin) at 2.60 angstrom resolution.
Class: transport protein
Keywords: merocyanin, CRABPII, retinoic acid, retinoid, PSB, protonated Schiff base, fluorescence, CRABP, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-11-30, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (58)
      • engineered (110)
      • engineered (120)
      • engineered (131)
    Domains in SCOPe 2.08: d3fepa_
  • Heterogens: LMC, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fepA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvwt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    etmtaddvvctkvyvre