PDB entry 3fen

View 3fen on RCSB PDB site
Description: Crystal structure of the R132K:R111L:A32E mutant of cellular retinoic acid-binding protein II at 1.56 angstrom resolution
Class: transport protein
Keywords: CRABPII, retinoic acid, retinoid, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-11-30, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (31)
      • engineered (110)
      • engineered (131)
    Domains in SCOPe 2.07: d3fena_
  • Chain 'B':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (110)
      • engineered (131)
    Domains in SCOPe 2.07: d3fenb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fenA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkievaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    ltmtaddvvctkvyvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fenB (B:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkievaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    ltmtaddvvctkvyvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fenB (B:)
    pnfsgnwkiirsenfeellkvlgvnpaveikqegdtfyiktsttvrtteinfkvgeefee
    qtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeliltmtaddvvctkv
    yvre