PDB entry 3fem

View 3fem on RCSB PDB site
Description: Structure of the synthase subunit Pdx1.1 (Snz1) of PLP synthase from Saccharomyces cerevisiae
Class: biosynthetic protein, transferase
Keywords: (BETA/ALPHA)8-BARREL, SYNTHASE, Pyridoxine biosynthesis, BIOSYNTHETIC PROTEIN, TRANSFERASE
Deposited on 2008-11-30, released 2009-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.163
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fema_
  • Chain 'B':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3femb_
  • Chain 'C':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3femc_
  • Chain 'D':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3femd_
  • Chain 'E':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3feme_
  • Chain 'F':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1, Snz1p, YM6543.03, YMR096W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3femf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3femA (A:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femA (A:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3femB (B:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femB (B:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3femC (C:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femC (C:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3femD (D:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femD (D:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3femE (E:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femE (E:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3femF (F:)
    mtgedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrm
    sdpkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkf
    kvpfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlksed
    diakvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifk
    ssnpvrlatavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3femF (F:)
    gedfkiksglaqmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsd
    pkmikdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkv
    pfvcgakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddi
    akvaeemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkss
    npvrlatavveatthfdnpskllevssdlgelmggvsiesi