PDB entry 3fea
View 3fea on RCSB PDB site
Description: Crystal Structure of HdmX bound to the p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2 at 1.33A
Class: cell cycle
Keywords: HdmX, Hdm4, human Mdm4, human MdmX, protein-protein interaction, p53, Metal-binding, Nucleus, Polymorphism, Zinc, Zinc-finger, CELL CYCLE
Deposited on
2008-11-28, released
2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-01, with a file datestamp of
2017-10-27.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mdm4 protein
Species: Homo sapiens [TaxId:9606]
Gene: mdm4, mdmx
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3feaa_ - Chain 'L':
Compound: p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: MPD, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3feaA (A:)
gpdsasrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeq
hmvycggdllgellgrqsfsvkdpsplydmlrknlvtlat
Sequence, based on observed residues (ATOM records): (download)
>3feaA (A:)
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlvt
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.