PDB entry 3fea

View 3fea on RCSB PDB site
Description: Crystal Structure of HdmX bound to the p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2 at 1.33A
Class: cell cycle
Keywords: HdmX, Hdm4, human Mdm4, human MdmX, protein-protein interaction, p53, Metal-binding, Nucleus, Polymorphism, Zinc, Zinc-finger, CELL CYCLE
Deposited on 2008-11-28, released 2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3feaa_
  • Chain 'L':
    Compound: p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FEA
  • Chain 'M':
    Compound: p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FEA
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3feaA (A:)
gpdsasrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeq
hmvycggdllgellgrqsfsvkdpsplydmlrknlvtlat

    Sequence, based on observed residues (ATOM records): (download) 
    >3feaA (A:)
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlvt

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.