PDB entry 3fe9

View 3fe9 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera with a serendipitous ligand soaked at pH 7.0
Class: Pheromone binding protein
Keywords: Pheromone binding protein, honey bee, Apis mellifera, signal transduction, queen mandibular protein
Deposited on 2008-11-28, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pheromone-binding protein ASP1
  Species: Apis mellifera [TaxId:7460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U9J6 (Start-118)
  Domains in SCOPe 2.08: d3fe9a_
• Heterogens: CMJ, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3fe9A (A:)
  apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
  deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3fe9A (A:)
  dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
  anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi