PDB entry 3fe8

View 3fe8 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera with a serendipitous ligand soaked at pH 4.0
Class: Pheromone binding protein
Keywords: pheromone binding protein, honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH
Deposited on 2008-11-28, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pheromone-binding protein ASP1
  Species: Apis mellifera [TaxId:7460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U9J6 (0-118)
  Domains in SCOPe 2.08: d3fe8a_
• Heterogens: CMJ, GOL, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fe8A (A:)
  apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
  deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi