PDB entry 3fe4

View 3fe4 on RCSB PDB site
Description: Crystal Structure of Human Carbonic Anhydrase vi
Class: lyase
Keywords: CARBONIC ANHYDRASE, SECRETION, METAL BINDING, Structural Genomics, Structural Genomics Consortium, SGC, Glycoprotein, Lyase, Metal-binding, Secreted
Deposited on 2008-11-27, released 2008-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CA6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fe4a_
  • Chain 'B':
    Compound: Carbonic anhydrase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CA6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fe4b_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fe4A (A:)
    msdwtysegaldeahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefp
    mvnnghtvqislpstmrmtvadgtvyiaqqmhfhwggasseisgsehtvdgirhvieihi
    vhynskyksydiaqdapdglavlaafvevknypentyysnfishlanikypgqrttltgl
    dvqdmlprnlqhyytyhgslttppctenvhwfvladfvklsrtqvwklenslldhrnkti
    hndyrrtqplnhrvvesnfpnqeytlgsefqaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fe4A (A:)
    eahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefpmvnnghtvqisl
    pstmrmtvadgtvyiaqqmhfhwggisgsehtvdgirhvieihivhynskyksydiaqda
    pdglavlaafvevknypentyysnfishlanikypgqrttltgldvqdmlprnlqhyyty
    hgslttppctenvhwfvladfvklsrtqvwklenslldhrnktihndyrrtqplnhrvve
    snfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fe4B (B:)
    msdwtysegaldeahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefp
    mvnnghtvqislpstmrmtvadgtvyiaqqmhfhwggasseisgsehtvdgirhvieihi
    vhynskyksydiaqdapdglavlaafvevknypentyysnfishlanikypgqrttltgl
    dvqdmlprnlqhyytyhgslttppctenvhwfvladfvklsrtqvwklenslldhrnkti
    hndyrrtqplnhrvvesnfpnqeytlgsefqaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fe4B (B:)
    ahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefpmvnnghtvqislp
    stmrmtvadgtvyiaqqmhfhwggeisgsehtvdgirhvieihivhynskyksydiaqda
    pdglavlaafvevknypentyysnfishlanikypgqrttltgldvqdmlprnlqhyyty
    hgslttppctenvhwfvladfvklsrtqvwklenslldhrnktihndyrrtqplnhrvve
    snfpn