PDB entry 3fe2

View 3fe2 on RCSB PDB site
Description: Human DEAD-BOX RNA helicase DDX5 (P68), conserved domain I in complex with ADP
Class: Hydrolase
Keywords: RNA HELICASE, DEAD, ADP, ATP-binding, Hydrolase, Nucleotide-binding, RNA-binding, Helicase, Methylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Spliceosome, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2008-11-27, released 2008-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX5
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fe2a_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX5
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fe2b_
  • Heterogens: SO4, ADP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fe2A (A:)
    smrtaqevetyrrskeitvrghncpkpvlnfyeanfpanvmdviarqnfteptaiqaqgw
    pvalsgldmvgvaqtgsgktlsyllpaivhinhqpflergdgpiclvlaptrelaqqvqq
    vaaeycracrlkstciyggapkgpqirdlergveiciatpgrlidflecgktnlrrttyl
    vldeadrmldmgfepqirkivdqirpdrqtlmwsatwpkevrqlaedflkdyihinigal
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fe2A (A:)
    qevetyrrskeitvrghncpkpvlnfyeanfpanvmdviarqnfteptaiqaqgwpvals
    gldmvgvaqtgsgktlsyllpaivhinhqpflergdgpiclvlaptrelaqqvqqvaaey
    cracrlkstciyggapkgpqirdlergveiciatpgrlidflecgktnlrrttylvldea
    drmldmgfepqirkivdqirpdrqtlmwsatwpkevrqlaedflkdyihiniga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fe2B (B:)
    smrtaqevetyrrskeitvrghncpkpvlnfyeanfpanvmdviarqnfteptaiqaqgw
    pvalsgldmvgvaqtgsgktlsyllpaivhinhqpflergdgpiclvlaptrelaqqvqq
    vaaeycracrlkstciyggapkgpqirdlergveiciatpgrlidflecgktnlrrttyl
    vldeadrmldmgfepqirkivdqirpdrqtlmwsatwpkevrqlaedflkdyihinigal
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fe2B (B:)
    qevetyrrskeitvrghncpkpvlnfyeanfpanvmdviarqnfteptaiqaqgwpvals
    gldmvgvaqtgsgktlsyllpaivhinhqpflergdgpiclvlaptrelaqqvqqvaaey
    cracrlkstciyggapkgpqirdlergveiciatpgrlidflecgktnlrrttylvldea
    drmldmgfepqirkivdqirpdrqtlmwsatwpkevrqlaedflkdyihiniga