PDB entry 3fdw

View 3fdw on RCSB PDB site
Description: Crystal structure of a C2 domain from human synaptotagmin-like protein 4
Class: lipid binding protein
Keywords: STRUCTURAL GENOMICS, PHOSPHOLIPID BINDING, Alternative splicing, Cell membrane, Cytoplasmic vesicle, Membrane, Metal-binding, Phosphoprotein, Polymorphism, Zinc, Zinc-finger, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LIPID BINDING PROTEIN
Deposited on 2008-11-26, released 2008-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-12-23, with a file datestamp of 2008-12-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-like protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SYTL4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3fdwa_
  • Chain 'B':
    Compound: Synaptotagmin-like protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SYTL4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3fdwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fdwA (A:)
    mslgnifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrq
    gkrktsikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdsw
    kldkkldhclplhgkisaeseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fdwA (A:)
    ifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrqgkrkt
    sikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdswkldkk
    ldhclplhgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fdwB (B:)
    mslgnifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrq
    gkrktsikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdsw
    kldkkldhclplhgkisaeseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fdwB (B:)
    ifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrqgkrkt
    sikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdswkldkk
    ldhclplhgk