PDB entry 3fdr

View 3fdr on RCSB PDB site
Description: Crystal structure of TDRD2
Class: RNA binding protein
Keywords: Tdrd2, Tudor, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, RNA-binding, RNA BINDING PROTEIN
Deposited on 2008-11-26, released 2009-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor and KH domain-containing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TDRKH, TDRD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fdra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3fdrA (A:)
gsrslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldl
yfvdfgdngdcplkdlralrsdflslpfqaiecs

    Sequence, based on observed residues (ATOM records): (download) 
    >3fdrA (A:)
lqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyfvd
fgdngdcplkdlralrsdflslpfqaiec