PDB entry 3fdo

View 3fdo on RCSB PDB site
Description: Structure of human MDMX in complex with high affinity peptide
Class: cell cycle
Keywords: MDMX, MDM4, MDM-X, MDM-4, p53, MDM2, CELL CYCLE
Deposited on 2008-11-26, released 2008-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein Mdm4
  Species: Homo sapiens [TaxId:9606]
  Gene: mdm4, mdmx
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15151 (1-89)
    • expression tag (0)
  Domains in SCOPe 2.08: d3fdoa1, d3fdoa2
• Chain 'B':
  Compound: Synthetic high affinity peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3FDO (0-11)
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fdoA (A:)
  iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
  gellgrqsfsvkdpsplydmlrknlvtlat
  

  
  
• Chain 'B':
  No sequence available.