PDB entry 3fdc

View 3fdc on RCSB PDB site
Description: Crystal Structure of Avidin
Class: protein binding
Keywords: beta barrel, Biotin, Glycoprotein, Polymorphism, Secreted, PROTEIN BINDING
Deposited on 2008-11-25, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • variant (33)
      • conflict (52)
    Domains in SCOPe 2.07: d3fdca_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • variant (33)
      • conflict (52)
    Domains in SCOPe 2.07: d3fdcb_
  • Heterogens: BTF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fdcA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fdcA (A:)
    csltgkwtndlgsnmtigavnsrgeftgtyttavtatneikesplhgtentinkrtqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fdcB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fdcB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentkrtqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl