PDB entry 3fdb

View 3fdb on RCSB PDB site
Description: Crystal structure of a putative plp-dependent beta-cystathionase (aecd, dip1736) from corynebacterium diphtheriae at 1.99 A resolution
Class: transferase
Keywords: Plp-dependent transferase-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, transferase
Deposited on 2008-11-25, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative PLP-dependent beta-cystathionase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: aecD, DIP1736, NP_940074.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NFZ9 (1-376)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3fdba1, d3fdba2
  • Heterogens: NA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fdbA (A:)
    gmqfpsiedlrarntmkwtrygqgvlplwvaesdfstcpavlqaitdavqreafgyqpdg
    sllsqataefyadrygyqarpewifpipdvvrglyiaidhftpaqskvivptpayppffh
    llsatqregifidatgginlhdvekgfqagarsillcnpynplgmvfapewlnelcdlah
    rydarvlvdeihaplvfdgqhtvaagvsdtaasvcititapskawniaglkcaqiifsnp
    sdaehwqqlspvikdgastlgliaaeaayrygtdflnqevaylknnhdfllheipkripg
    akitpmqatylmwidfrdttiegspseffiekakvamndgawfgedgtgfcrlnfatsre
    vleeaidrmakavshht